skip to main |
skip to sidebar
Saturday, February 24, 2007
Queen Christina
Posted by
scottlord- Swedish Film and the Svenska Filminstitutet
at
10:13 PM
0
comments
Links to this post


Friday, February 23, 2007
Tuesday, February 20, 2007
Silent movies part 1
Posted by
scottlord- Swedish Film and the Svenska Filminstitutet
at
10:11 PM
0
comments
Links to this post


Monday, February 12, 2007
mary pickford
http://silent-film-swicki.eurekster.com
http://www.geocities.com/lord02141/scottlord.html
Monday, February 5, 2007
Friday, February 2, 2007
hsitory of swedish film and the swedish film institute
Faves: scottlord 23 Silent Film - scottlord- Ingmar Bergman swicki ...
-
scottlord 23 Silent Film - scottlord- Ingmar Bergman swicki - powered by
eurekster ... Ingmar Bergman, Bergman, Svenska, Silent Garbo, Greta Garbo
Swedish ...
17 minutes ago
Scott Lord - scottlord- Swedish Film and the Svenska Filminstit *...*
-
Google Blog Search: scottlord-swedish-silent-film-swicki Ase Kleveland
Svenska Filminstitutet. -.
del.icio.us/tag/scottlord-swedish-silent-film-swicki+sven...
2 hours ago
Scott Lord - scottlord- Swedish Film and the *Svenska* Filminstit *...*
-
scottlord- Swedish Film and the *Svenska* Filminstit. -. Recent Uploads
tagged scottlordswedishsilentfilmswickisvenskafil. -. Google Blog Search: *scottlord...
2 hours ago
Scott Lord - scottlord- Swedish Film and the Svenska Filminstit *...*
-
Google Blog Search: scottlord-swedish-silent-film-swicki Ase Kleveland
Svenska Filminstitutet. -.
del.icio.us/tag/scottlord-swedish-silent-film-swicki+sven...
2 hours ago
*Scott Lord* - *scottlord* Svensk Filmhistoria: mars 2008
-
*scottlord* Svensk Filmhistoria. The History of Swedish Film, from the
Swedish Silent Film of Greta Garbo and Victor Sjostrom to *Ingmar Bergman*including A...
2 hours ago
[from scottlordgoogle] scottlordgoo | My Bookmarks | Mister Wong
-
[image: http://delicious.com] Bookmark this on Delicious - Saved by
scottlordgoogle to Swedish Film Svenska
Svenska+Filmingstitutet+scottlord+Swedish+Film...
6 days ago
Pageflakes Community - scottlord Swedish and Silent Film by lord02141
-
... your scottlord Swedish and Silent Film by lord02141 ...
scottlord-swedish-silent-film-swicki" via sc..., " Svensk Filmhistoria" via
scott Swedish Film ...
2 weeks ago
Scott Lord
-
Scott Lord
Greta Garbo Group Page - Blogdigger Groups - Blogdigger search for
*scottlord Google CSE Custom Seach Engine* · Blogdigger search for
*scott...
2 weeks ago
Scott Lord: AltaVista Søk: Swedish Film BIngmar/B BBergman/B Eva Dahlbe
-
b.../b Bscottlord/B Swedish Film blog - Google Blog-Suche *Bscottlord/B*-
*Swedish Film* and the Svenska Filminstit: christina lin *…* - Greta Garbo
Bswick...
4 weeks ago
Google Base: Modern Swedish Film
-
[image: http://delicious.com] Bookmark this on Delicious - Saved by
scottlord to imported, Greta Garbo, Sweidsh Film, Ingmar Bergman Bookmarks
Unlabeled -...
2 months ago
link:scottlord.blogspot.com - IceRocket Blog Search Swedish Film
-
Tagged by scottlord under Film, Institute, Swedish,
7 months ago
scottlord-swedish-silent-film-swicki - Search
-
[image: http://delicious.com] Bookmark this on Delicious - Saved by
scottlordswedish to imported, Svenska Filminstitutet, Swedish Film, Silent
Film scottl...
8 months ago
www.geocities.com/lord02141/scottlord12.html: Blog Reactions on Technorati
-
[image: http://delicious.com] Bookmark this on Delicious - Saved by
scottlordswedish to imported, Svenska Filminstitutet, Swedish Film, Silent
Film scottl...
8 months ago
Post: Victor Sjostrom His Lord's Will (Han nads testamente) [by scott]
-
His Lord's Will (His Grace's Will, Hans nads testamente, 1919) Directed by
Victor Sjostrom. Refilmed by Per Lindberg in 1940,
11 months ago
Google Reader -"Swedish Film and the Svenska Filminstitutet" via scott
-
[image: http://delicious.com] Bookmark this on Delicious - Saved by
scottlord to SwedishFilmInstitute Sweden SvenskaFilminstitutet
SwedishFilmInstituteswi...
1 year ago
Post: Ingmar Bergman [by scott]
-
Please read my webpage on the films of Swedish Film director Ingmar Bergman.
1 year ago
Google Blog Search: scottlord-swedish-silent-film-swicki Greta ...
-
Google Blog Search: *scottlord-swedish-silent-film-swicki* Greta Garbo
Svenska Filminstituet. aA : - + pdf · Infos · Unsubscribe *...*
1 year ago
Economist (US), The - Spoking Scott.(Lord Justice Sir Richard Scott; dearth
of non-politicized UK independent commissions)(Column)
-
February 17, 1996 -- The John Major government's trashing of Scott's inquiry
on UK arms sales to Iraq will make it harder to find bold and apolitical
indep...
12 years ago

scottlord
- scottlord blog
- modern swedish film
- Swedish Silent Film blog
- modern swedish film
- modern swedish film
- modern swedish film
- scottlord blog
- scottlord blog
- scottlord blog
- scottlord blog
- Greta Garbo group links
- scottlord Swedish Film search engine group
- Greta Garbo group
- Greta Garbo search- Greta Garbo
- Greta Garbo search engine
- Swedish Film search-Swedish Film Institute
- Silent Film search engine
- Swedish Silent Film
- Swedish Silent Film
- Swedish Film search engine
- Swedish Silent Film
- Greta Garbo
- Swedish Film and the Svenska Filminstitutet
- http://del.icio.us/rss/scottlord
- scottlord blog
- modern swedish film
- Swedish Silent Film blog
- modern swedish film
- modern swedish film
- modern swedish film
- scottlord blog
- scottlord blog
- scottlord blog
- scottlord blog
- Greta Garbo group links
- scottlord Swedish Film search engine group
- Greta Garbo group
- Greta Garbo search- Greta Garbo
- Greta Garbo search engine
- Swedish Film search-Swedish Film Institute
- Silent Film search engine
- Swedish Silent Film

Blog Archive
▼
2008
(226)
►
October
(9)- My Widget
- Morianerna
- Morianerna
- Morianerna
- Kattorna (The Cats)
- Meg Westergren Svenska Komedienner
- gretagarbo - Scott Lord on Diigo
- My Widget
- Swedish Film, Silent Film, Greta Garbo
►
September
(5)- Pytagoras swing
- Swedish advertising
- Flesh and the Devil (1926) - 1/11
- Joyless Street - 61 minutes version 1925
- Greta Garbo First Scene 1924
►
August
(5)- Greta Garbo (Swedish Silent Film)
- Swedish and Silent Film Blogs RSS
- del.icio.us Svenska Filminstitutet, Greta Garbo, V...
- del.icio.us Svenska Filminstitutet, Greta Garbo, V...
- Silent Hollywood
►
July
(54)- Inga trailer (Cannon Films) Marie Liljedahl
- Crossposting to multiply from Blogger
- new dvds - inspiration for potential bi weekly hor...
- scottlord- Swedish Film and the Svenska Filminstit...
- scottlord Silent Greta Garbo
- site:www.geocities.com/lord02141/scottlordgretagar...
- site:www.geocities.com/lord02141/scottlordgretagar...
- site:www.geocities.com/lord02141/scottlordgretagar...
- http://www.geocities.com/lord02141/GretaGarbo.html...
- Sesam webbsök (hela webben) - Swedish Silent Fi......
- Sesam webbsök (hela webben) - Silent Film scott......
- Danish Silent Film site:www.geocities.com/lord0......
- Blogger: User Profile: scottlord- Swedish Film ......
- Ingmar Bergman
- Silent Hollywood
- Victor Sjostrom
- del.icio.us Svenska Filminstitutet, Greta Garbo, V...
- Swedish Film and the Svenska Filminstitutet
- Swedish and Silent Film social bookmarks
- Swedish and Silent Film Blogs RSS
- Greta Garbo
- Swedish Film and the Svenska Film Institute
- scottlord inposttitle:Greta Garbo - Google Blog Se...
- Christina Lindberg inpostauthor:scottlord - Google...
- Greta Garbo
- My Notebook Svenska Filmhistoria
- Greta Garbo

scottlord- Swedish Film and the Svenska Filminstitutet

- scottlord- Swedish Film and the Svenska Filminstitutet
- Swedish Film: Silent Swedish Film of Victor Sjostrom and Greta Garbo to Modern Swedish Film of Arne Mattsson and Ingmar Bergman
View my complete profile

Swedish Film and the Svenska Filminstitutet scottlord's Bookmarks
Greta Garbo more:greta_garbo - Google-søgning
AltaVista Sök: Greta Garbo domain:www.geocities...
Greta Garbo more:the_divine_woman_victor_seastr...
Greta Garbo more:victor_seastrom - Google-sökning
Greta Garbo more:greta_garbo - Google-haku

scottlord- Swedish Film and the Svenska Filminstit
scottlord-swedish silent film Swicki
Post: Victor Sjostrom His Lord's Will (Han nads testamente) [by scott]
Post: Rune Carlsten The Marriage Game (Aktenskaplekan) [by scott]
Post: Per Lindberg The Old Man's Coming (Gubben kommer) [by scott]
Post: Edvin Adolphson Brollopet i Branna [by scott]
Post: Swedish Sound Film John W. Brunius The Two of Us (Vi Tva) [by scott]

Greta Garbo Swicki
Post: As You Desire Me (Som du vill ha mig, 1934) [by scott]
Post: Edmund Goulding Greta Garbo [by scott]
Post: Queen Christina Greta Garbo [by scott]
Post: Greta Garbo Froken, Ni linknar Greta Garbo [by scott]
Post: Sven Garbo When Roses Bloom (Na Rosarna sla ut) [by scott]

Silent Film Swicki
Post: Rune Carlsten A Modern Robinson [by scott]
Post: Victor Sjostrom A Good Girl Should Solve Her Own Problems (Bra Flicka reder sig sjalv) [by scott]
Post: Victor Sjostrom Karin, Daughter of Ingmar (Karin Ingmarsdotter) [by scott]
Post: Victor Sjostrom The Sons of Ingmar (Ingmarssonera) [by scott]
Post: Gustaf Edgren The Young Lady of Bjorneborg (Froken pa Bjorneborg) [by scott]

scottlord-- modern swedish film Swicki
Sorry, no swicki data yet.
Post: Arne Mattsson The Teddy Bear (Bamse) [by scott]
Post: Arne Mattsson The Yellow Car (Den Gula bilen) [by scott]
Post: Swedish Film scottlord-swedish-silent-film-swicki [by scott]
Post: Vilgot Sjoman A Handful of Love En handfull karlek [by scott]

scottlord- Ingmar Bergman Swicki
Post: Ingmar Bergman [by scott]
Post: Ingmar Bergman Saraband [by scott]
Post: Ase Kleveland Svenska Filminstituet [by scott]
Post: Ingmar Bergman Through A Glass Darkly Sasom i en Spengel [by scott]
Post: Ingmar Bergman Winter Light Nattvardsgasterna [by scott]

scottlord- Swedish Film and the Svenska Filminstit
- noreply@blogger.com (scottlord- Swedish Film and the Svenska Filminstitutet)
Silent Hamlet (1920)--Ending Sequence
- noreply@blogger.com (scottlord- Swedish Film and the Svenska Filminstitutet)
Greta Garbo in "Love" 1927
- noreply@blogger.com (scottlord- Swedish Film and the Svenska Filminstitutet)
Lars Hanson
- noreply@blogger.com (scottlord- Swedish Film and the Svenska Filminstitutet)
My Widget
- noreply@blogger.com (scottlord- Swedish Film and the Svenska Filminstitutet)

Feed24: scottlord
scotts notesbøger Swedish and Silent Film
scottlord: Greta Garbo in The Divine Woman
scottlord sine notatbøker
Greta Garbo scottlord - Stockholm Search swicki...
Blogg: scottlord Swedish Film - Bloggar - Blog Toplist

scottlord- Swedish Film
Swedish Silent Film site:www.geocities.com/lord02141/scottlord23.ht...
Google Reader -"victor-sjostrom" via scottlord
Filer - Victor Sjostrom | Google Grupper
"Victor Sjostrom" via scott Swedish Film and th...
scottlord Swedish Film Google Bloggsok – Google Bloggsøk

del.icio.us/scottlord/swedishfilminstitute
Google Reader -"Swedish Film and the Svenska Filminstitutet" via scott
RSS - Sesam Greta Garbo Victor Sjostrom Svenska Filminstitutet
RSS - Sesam Swedish Film and the Svenska Filminstitutet
Swedish Film and the Svenska Filminstitutet, Swedish Silent and Sound Film
http://base.google.com/base/search?authorid=3234231&hl=en&gl=US&nd=1&output=rss&ie=utf8 Swedish Film and Greta Garbo search engine

del.icio.us/scottlord/scottlordgretagarbo
del.icio.us Svenska Filminstitutet, Greta Garbo...
Greta Garbo more:victor_seastrom_greta_garbo - ...
Greta Garbo
scottlord Blogportalen
scottlord Svensk Filmhistoria feed

Blue Dot: scottlord
scottlordgoo | My Bookmarks | Mister Wong
scottlordgoo | My Bookmarks | Mister Wong Swedish Film Svenska Filminstitutet
scottlord @ 2008-12-07T17:03:00
Silent Hamlet (1920)--Ending Sequence
Garbo

Scott Lord
Greta Garbo: oktober 2008
Greta Garbo: december 2008
Greta Garbo: Greta Garbo
scottlord- Swedish Film and the Svenska Filminstit: Kattorna (The
Swedish Film site:www.geocities.com/lord02141/scottlord5.html - Eniro

scottlord
- lord02141@yahoo.com
Silent Hamlet (1920)--Ending Sequence
- lord02141@yahoo.com
Garbo
- lord02141@yahoo.com
Lars Hanson
- lord02141@yahoo.com
Meg Westergren Svenska Komedienner
- lord02141@yahoo.com

del.icio.us/network/scottlord
[from scottlordgoogle] scottlordgoo | My Bookmarks | Mister Wong
[from scottlord] Swedish Film
[from scottlord] Swedish Film
[from scottlord] Swedish Film
[from scottlord] Swedish Film

No comments:
Post a Comment